PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.1
Common NameAMTR_s00021p00013790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 472aa    MW: 52557.5 Da    PI: 7.9645
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.1genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.8e-3262115255
                                 G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                             prlrWtp+LH +Fv+ave+LGG+++AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  evm_27.model.AmTr_v1.0_scaffold00021.1  62 PRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQLMNVKGLSIAHVKSHLQMYRS 115
                                             8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-3158116IPR009057Homeodomain-like
PROSITE profilePS5129413.10558118IPR017930Myb domain
SuperFamilySSF466896.63E-1560116IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-2362117IPR006447Myb domain, plants
PfamPF002495.6E-963114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MELGEERSGS SSNDSSGERF PSNSRKRSVD SCDQNSESWV KERDMKPATT GGVRQYVRSK  60
MPRLRWTPDL HLCFVHAVER LGGQDRATPK LVLQLMNVKG LSIAHVKSHL QMYRSKKVDD  120
SGQVISQPDR LIPGEDHYYA RGSSLQMQQQ FSKDNGTLFA AGGGKNIHDP DHLYGLLHRP  180
ILHSYDHRSN NFRQHDWVFK PYGFQGIGDN HGGSRSTFHV LGNNMVQNTV FRENGNRSMQ  240
ELFAIRGAAT SGGPLKLNHS IEERRYPNIQ RETGIGYRSE GIGVQGFDRQ IPPNFEWNCS  300
GQARANVVGS CQSSIVATMD QSIFGRSIAH NTMLTNRSHE ALTASDRHGS QFELSLQLPL  360
QQHGNDNLGM NLLDKPCEDT SPDGKRLNTS ELDLQLTLNP SLQKPHAEDI DSSLSLSLCT  420
PPSSSKENPQ ESGQPRDTMK TDLRLLEKDS SGQAPRRLST LDLTMSIRAL E*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW1PV100.0W1PV10_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-38G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]